Lineage for d1ki9c_ (1ki9 C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 483671Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 483672Protein Adenylate kinase [52554] (13 species)
  7. 483673Species Archaeon Methanococcus thermolithotrophicus [TaxId:2186] [89661] (1 PDB entry)
  8. 483676Domain d1ki9c_: 1ki9 C: [84406]

Details for d1ki9c_

PDB Entry: 1ki9 (more details), 2.76 Å

PDB Description: Adenylate kinase from Methanococcus thermolithotrophicus

SCOP Domain Sequences for d1ki9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ki9c_ c.37.1.1 (C:) Adenylate kinase {Archaeon Methanococcus thermolithotrophicus}
mknklvvvtgvpgvggttitqkameklseeginykmvnfgtvmfevaqeenlvedrdqmr
kldpdtqkriqklagrkiaemvkespvvvdthstiktpkgylpglpvwvlnelnpdiiiv
vetsgdeilirrlndetrnrdlettagieehqimnraaamtygvltgatvkiiqnknnll
dyaveelisvlr

SCOP Domain Coordinates for d1ki9c_:

Click to download the PDB-style file with coordinates for d1ki9c_.
(The format of our PDB-style files is described here.)

Timeline for d1ki9c_: