Lineage for d1kfza1 (1kfz A:155-214)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053886Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 2053887Species Caenorhabditis elegans, SEM-5 [TaxId:6239] [50073] (5 PDB entries)
    Sex muscle abnormal protein 5
  8. 2053894Domain d1kfza1: 1kfz A:155-214 [84391]
    Other proteins in same PDB: d1kfza2
    C-terminal domain

Details for d1kfza1

PDB Entry: 1kfz (more details)

PDB Description: Solution Structure of C-terminal Sem-5 SH3 Domain (Ensemble of 16 Structures)
PDB Compounds: (A:) sex muscle abnormal protein 5

SCOPe Domain Sequences for d1kfza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfza1 b.34.2.1 (A:155-214) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]}
etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvapynsn

SCOPe Domain Coordinates for d1kfza1:

Click to download the PDB-style file with coordinates for d1kfza1.
(The format of our PDB-style files is described here.)

Timeline for d1kfza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kfza2