SCOPe 2.02: Domain d1kdq.1: 1kdq A:,B:

Lineage for d1kdq.1 (1kdq A:,B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89340] (1 PDB entry)

8. Domain d1kdq.1: 1kdq A:,B: [84386]
   chymotrypsin B
   complexed with ca; mutant

Details for d1kdq.1

PDB Entry: 1kdq, 2.55 Å

PDB Description: crystal structure analysis of the mutant s189d rat chymotrypsin

PDB Compounds: (A:) chymotrypsin b, b chain, (B:) chymotrypsin b, c chain

SCOPe Domain Sequences for d1kdq.1:

Sequence; same for both SEQRES and ATOM records:

>g1kdq.1 b.47.1.2 (A:,B:) (alpha,gamma)-chymotrypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vngedaipgswpwqvslqdktgfhfcggslisedwvvtaahcgvktsdvvvagefdqgsd
eeniqvlkiaqvfknpkfnmftvrnditllklatpaqfsetvsavslpnvdddfppgtvc
attgwgktkyXtpeklqqaalpivseadckkswgskitdvmtcagasgvdscmgdsggpl
vcqkdgvwtlagivswgsgvcststpavysrvtalmpwvqqilean

Timeline for d1kdq.1:

• d1kdq.1 first appeared in SCOP 1.65
  
• d1kdq.1 appears in SCOPe 2.01
  
• d1kdq.1 appears in SCOPe 2.03
  
• d1kdq.1 appears in the current release, SCOPe 2.08