Lineage for d1kc8y_ (1kc8 Y:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720856Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 720857Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 720858Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 720859Protein Ribosomal protein L31e [54577] (1 species)
  7. 720860Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
  8. 720884Domain d1kc8y_: 1kc8 Y: [84380]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8y_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit
PDB Compounds: (Y:) ribosomal protein l31e

SCOP Domain Sequences for d1kc8y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8y_ d.29.1.1 (Y:) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1kc8y_:

Click to download the PDB-style file with coordinates for d1kc8y_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8y_: