Lineage for d1kc8s_ (1kc8 S:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723129Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 723130Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 723131Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 723132Protein Ribosomal protein L22 [54845] (2 species)
  7. 723133Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (39 PDB entries)
  8. 723157Domain d1kc8s_: 1kc8 S: [84374]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8s_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit
PDB Compounds: (S:) ribosomal protein l22

SCOP Domain Sequences for d1kc8s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8s_ d.55.1.1 (S:) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOP Domain Coordinates for d1kc8s_:

Click to download the PDB-style file with coordinates for d1kc8s_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8s_: