Lineage for d1kc8q_ (1kc8 Q:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645350Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 645351Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 645352Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 645353Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 645354Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (40 PDB entries)
  8. 645378Domain d1kc8q_: 1kc8 Q: [84372]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8q_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit
PDB Compounds: (Q:) ribosomal protein l19e

SCOP Domain Sequences for d1kc8q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8q_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1kc8q_:

Click to download the PDB-style file with coordinates for d1kc8q_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8q_: