Lineage for d1kc8o_ (1kc8 O:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 587067Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 587068Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 587069Protein Ribosomal protein L18 (L18p) [53139] (3 species)
  7. 587070Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (19 PDB entries)
  8. 587076Domain d1kc8o_: 1kc8 O: [84370]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc8o_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1kc8o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc8o_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1kc8o_:

Click to download the PDB-style file with coordinates for d1kc8o_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8o_: