Lineage for d1kc8m_ (1kc8 M:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480304Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 480305Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 480306Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 480307Protein Ribosomal protein L15 (L15p) [52082] (1 species)
  7. 480308Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (19 PDB entries)
  8. 480314Domain d1kc8m_: 1kc8 M: [84368]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_

Details for d1kc8m_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1kc8m_:

Sequence, based on SEQRES records: (download)

>d1kc8m_ c.12.1.1 (M:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1kc8m_ c.12.1.1 (M:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOP Domain Coordinates for d1kc8m_:

Click to download the PDB-style file with coordinates for d1kc8m_.
(The format of our PDB-style files is described here.)

Timeline for d1kc8m_: