| Class b: All beta proteins [48724] (176 folds) |
| Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) ![]() automatically mapped to Pfam PF00238 |
| Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
| Protein Ribosomal protein L14 [50195] (5 species) |
| Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries) Uniprot P22450 |
| Domain d1kc8l_: 1kc8 L: [84367] Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ complexed with bls, cd, cl, k, mg, na |
PDB Entry: 1kc8 (more details), 3.01 Å
SCOPe Domain Sequences for d1kc8l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc8l_ b.39.1.1 (L:) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv
Timeline for d1kc8l_:
View in 3DDomains from other chains: (mouse over for more information) d1kc81_, d1kc82_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ |