Lineage for d1kc84_ (1kc8 4:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344238Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 344467Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 344498Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 344499Protein Ribosomal protein L44e [57837] (1 species)
  7. 344500Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (12 PDB entries)
  8. 344506Domain d1kc84_: 1kc8 4: [84355]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc83_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc84_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1kc84_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc84_ g.41.8.3 (4:) Ribosomal protein L44e {Archaeon Haloarcula marismortui}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1kc84_:

Click to download the PDB-style file with coordinates for d1kc84_.
(The format of our PDB-style files is described here.)

Timeline for d1kc84_: