Lineage for d1kc83_ (1kc8 3:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286285Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies)
    not a true fold
  4. 286286Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 286287Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 286288Protein Ribosomal protein L39e [48664] (1 species)
  7. 286289Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (12 PDB entries)
  8. 286295Domain d1kc83_: 1kc8 3: [84354]
    Other proteins in same PDB: d1kc81_, d1kc82_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc83_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1kc83_:

Sequence, based on SEQRES records: (download)

>d1kc83_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1kc83_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOP Domain Coordinates for d1kc83_:

Click to download the PDB-style file with coordinates for d1kc83_.
(The format of our PDB-style files is described here.)

Timeline for d1kc83_: