| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies) not a true fold |
Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) ![]() interrupted alpha-helix |
| Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
| Protein Ribosomal protein L39e [48664] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (12 PDB entries) |
| Domain d1kc83_: 1kc8 3: [84354] Other proteins in same PDB: d1kc81_, d1kc82_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ complexed with bls, cd, cl, k, mg, na |
PDB Entry: 1kc8 (more details), 3.01 Å
SCOP Domain Sequences for d1kc83_:
Sequence, based on SEQRES records: (download)
>d1kc83_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
>d1kc83_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
Timeline for d1kc83_:
View in 3DDomains from other chains: (mouse over for more information) d1kc81_, d1kc82_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ |