Lineage for d1kc82_ (1kc8 2:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751154Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
  6. 751155Protein Ribosomal protein L37e [57834] (1 species)
  7. 751156Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
  8. 751180Domain d1kc82_: 1kc8 2: [84353]
    Other proteins in same PDB: d1kc81_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_
    complexed with bls, cd, cl, k, mg, na

Details for d1kc82_

PDB Entry: 1kc8 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit
PDB Compounds: (2:) ribosomal protein l37e

SCOP Domain Sequences for d1kc82_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc82_ g.41.8.2 (2:) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOP Domain Coordinates for d1kc82_:

Click to download the PDB-style file with coordinates for d1kc82_.
(The format of our PDB-style files is described here.)

Timeline for d1kc82_: