| Class g: Small proteins [56992] (72 folds) |
| Fold g.41: Rubredoxin-like [57769] (13 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) ![]() |
| Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein) |
| Protein Ribosomal protein L37e [57834] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (18 PDB entries) |
| Domain d1kc82_: 1kc8 2: [84353] Other proteins in same PDB: d1kc81_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ complexed with bls, cd, cl, k, mg, na |
PDB Entry: 1kc8 (more details), 3.01 Å
SCOP Domain Sequences for d1kc82_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc82_ g.41.8.2 (2:) Ribosomal protein L37e {Archaeon Haloarcula marismortui}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d1kc82_:
View in 3DDomains from other chains: (mouse over for more information) d1kc81_, d1kc83_, d1kc84_, d1kc8c1, d1kc8c2, d1kc8d_, d1kc8e_, d1kc8f_, d1kc8g1, d1kc8g2, d1kc8h_, d1kc8i_, d1kc8j_, d1kc8k_, d1kc8l_, d1kc8m_, d1kc8n_, d1kc8o_, d1kc8p_, d1kc8q_, d1kc8r_, d1kc8s_, d1kc8t_, d1kc8u_, d1kc8v_, d1kc8w_, d1kc8x_, d1kc8y_, d1kc8z_ |