Lineage for d1k73y_ (1k73 Y:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502174Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 502175Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 502176Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 502177Protein Ribosomal protein L31e [54577] (1 species)
  7. 502178Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (19 PDB entries)
  8. 502195Domain d1k73y_: 1k73 Y: [84341]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73z_

Details for d1k73y_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1k73y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73y_ d.29.1.1 (Y:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1k73y_:

Click to download the PDB-style file with coordinates for d1k73y_.
(The format of our PDB-style files is described here.)

Timeline for d1k73y_: