Lineage for d1k73v_ (1k73 V:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429921Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 429922Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families) (S)
  5. 430049Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 430050Protein Ribosomal protein L24e [57750] (1 species)
  7. 430051Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (18 PDB entries)
  8. 430067Domain d1k73v_: 1k73 V: [84338]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73v_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1k73v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73v_ g.39.1.6 (V:) Ribosomal protein L24e {Archaeon Haloarcula marismortui}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOP Domain Coordinates for d1k73v_:

Click to download the PDB-style file with coordinates for d1k73v_.
(The format of our PDB-style files is described here.)

Timeline for d1k73v_: