SCOP 1.73: Domain d1k73t_: 1k73 T:

Lineage for d1k73t_ (1k73 T:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (44 PDB entries)

8. Domain d1k73t_: 1k73 T: [84336]
   Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
   complexed with anm, cd, cl, k, mg, na

Details for d1k73t_

PDB Entry: 1k73, 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit

PDB Compounds: (T:) ribosomal protein l23

SCOP Domain Sequences for d1k73t_:

Sequence; same for both SEQRES and ATOM records:

>d1k73t_ d.12.1.1 (T:) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d1k73t_:

• d1k73t_ first appeared in SCOP 1.65
  
• d1k73t_ appears in SCOP 1.71
  
• d1k73t_ appears in SCOP 1.75
  
• d1k73t_ appears in the current release, SCOPe 2.08