Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) some topological similarity to prokaryotic ribosomal protein L17 |
Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
Protein Ribosomal protein L22 [54845] (2 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (39 PDB entries) |
Domain d1k73s_: 1k73 S: [84335] Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ complexed with anm, cd, cl, k, mg, na |
PDB Entry: 1k73 (more details), 3.01 Å
SCOP Domain Sequences for d1k73s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k73s_ d.55.1.1 (S:) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]} gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg eqqgrkpramgrasawnspqvdvelileep
Timeline for d1k73s_:
View in 3D Domains from other chains: (mouse over for more information) d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ |