| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) ![]() interrupted alpha-helix automatically mapped to Pfam PF00832 |
| Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
| Protein Ribosomal protein L39e [48664] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
| Domain d1k733_: 1k73 3: [84315] Other proteins in same PDB: d1k731_, d1k732_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ complexed with anm, cd, cl, k, mg, na |
PDB Entry: 1k73 (more details), 3.01 Å
SCOPe Domain Sequences for d1k733_:
Sequence, based on SEQRES records: (download)
>d1k733_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
>d1k733_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
Timeline for d1k733_:
View in 3DDomains from other chains: (mouse over for more information) d1k731_, d1k732_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_ |