Lineage for d1k38a_ (1k38 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244681Protein Class D beta-lactamase [56622] (4 species)
  7. 2244789Species Salmonella typhimurium, OXA-2 [TaxId:90371] [90083] (1 PDB entry)
  8. 2244790Domain d1k38a_: 1k38 A: [84303]
    complexed with fmt

Details for d1k38a_

PDB Entry: 1k38 (more details), 1.5 Å

PDB Description: crystal structure of the class d beta-lactamase oxa-2
PDB Compounds: (A:) Beta-lactamase OXA-2

SCOPe Domain Sequences for d1k38a_:

Sequence, based on SEQRES records: (download)

>d1k38a_ e.3.1.1 (A:) Class D beta-lactamase {Salmonella typhimurium, OXA-2 [TaxId: 90371]}
tlersdwrkffsefqakgtivvaderqadramlvfdpvrskkryspastfkiphtlfald
agavrdefqifrwdgvnrgfaghnqdqdlrsamrnstvwvyelfakeigddkarrylkki
dygnadpstsngdywiegslaisaqeqiaflrklyrnelpfrvehqrlvkdlmiveagrn
wilraktgwegrmgwwvgwvewptgsvffalnidtpnrmddlfkreaivrailrsiealp
p

Sequence, based on observed residues (ATOM records): (download)

>d1k38a_ e.3.1.1 (A:) Class D beta-lactamase {Salmonella typhimurium, OXA-2 [TaxId: 90371]}
tlersdwrkffsefqakgtivvaderqadramlvfdpvrskkryspastfkiphtlfald
agavrdefqifrwdgvnrgfaghnqdqdlrsamrnstvwvyelfakeigddkarrylkki
dygnadpstgdywiegslaisaqeqiaflrklyrnelpfrvehqrlvkdlmiveagrnwi
lraktgwegrmgwwvgwvewptgsvffalnidtpnrmddlfkreaivrailrsiealpp

SCOPe Domain Coordinates for d1k38a_:

Click to download the PDB-style file with coordinates for d1k38a_.
(The format of our PDB-style files is described here.)

Timeline for d1k38a_: