Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d1k2db1: 1k2d B:93-190 [84293] Other proteins in same PDB: d1k2da1, d1k2da2, d1k2da3, d1k2db2 complexed with nag, ndg |
PDB Entry: 1k2d (more details), 2.2 Å
SCOPe Domain Sequences for d1k2db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2db1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} rleqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd wtfqvlvmlemtprrgevytchvehpslkspitvewra
Timeline for d1k2db1: