SCOPe 2.02: Domain d1k2db1: 1k2d B:93-190

Lineage for d1k2db1 (1k2d B:93-190)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1k2db1: 1k2d B:93-190 [84293]
   Other proteins in same PDB: d1k2da1, d1k2da2, d1k2db2
   complexed with nag, ndg

Details for d1k2db1

PDB Entry: 1k2d, 2.2 Å

PDB Description: crystal structure of the autoimmune mhc class ii i-au complexed with myelin basic protein 1-11 at 2.2a

PDB Compounds: (B:) H-2 class II histocompatibility antigen, A-U beta chain

SCOPe Domain Sequences for d1k2db1:

Sequence; same for both SEQRES and ATOM records:

>d1k2db1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
rleqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtprrgevytchvehpslkspitvewra

Timeline for d1k2db1:

• d1k2db1 first appeared in SCOP 1.65
  
• d1k2db1 appears in SCOPe 2.01
  
• d1k2db1 appears in SCOPe 2.03
  
• d1k2db1 appears in the current release, SCOPe 2.08