Lineage for d1k2da2 (1k2d A:1-81)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198436Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1198509Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)
  8. 1198514Domain d1k2da2: 1k2d A:1-81 [84292]
    Other proteins in same PDB: d1k2da1, d1k2db1, d1k2db2
    complexed with nag, ndg

Details for d1k2da2

PDB Entry: 1k2d (more details), 2.2 Å

PDB Description: crystal structure of the autoimmune mhc class ii i-au complexed with myelin basic protein 1-11 at 2.2a
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOPe Domain Sequences for d1k2da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2da2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg
lqniatgkhnlgvltkrsnstp

SCOPe Domain Coordinates for d1k2da2:

Click to download the PDB-style file with coordinates for d1k2da2.
(The format of our PDB-style files is described here.)

Timeline for d1k2da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k2da1