Lineage for d1jwud2 (1jwu D:122-239)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325763Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 325764Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 325804Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 325805Species Staphylococcus aureus [TaxId:1280] [54345] (5 PDB entries)
  8. 325807Domain d1jwud2: 1jwu D:122-239 [84253]
    Other proteins in same PDB: d1jwua1, d1jwua2, d1jwub1, d1jwub2, d1jwud1
    mutant

Details for d1jwud2

PDB Entry: 1jwu (more details), 2.3 Å

PDB Description: Crystal Structure of the Complex of the MHC Class II Molecule HLA-DR1 (HA peptide 306-318) with the superantigen SEC3 Variant 3B2

SCOP Domain Sequences for d1jwud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwud2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOP Domain Coordinates for d1jwud2:

Click to download the PDB-style file with coordinates for d1jwud2.
(The format of our PDB-style files is described here.)

Timeline for d1jwud2: