Lineage for d1jwud1 (1jwu D:1-121)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 374369Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 374409Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 374410Species Staphylococcus aureus [TaxId:1280] [50229] (7 PDB entries)
  8. 374414Domain d1jwud1: 1jwu D:1-121 [84252]
    Other proteins in same PDB: d1jwua1, d1jwua2, d1jwub1, d1jwub2, d1jwud2
    mutant

Details for d1jwud1

PDB Entry: 1jwu (more details), 2.3 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2

SCOP Domain Sequences for d1jwud1:

Sequence, based on SEQRES records: (download)

>d1jwud1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1jwud1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegn

SCOP Domain Coordinates for d1jwud1:

Click to download the PDB-style file with coordinates for d1jwud1.
(The format of our PDB-style files is described here.)

Timeline for d1jwud1: