SCOPe 2.06: Domain d1jwub2: 1jwu B:1-92

Lineage for d1jwub2 (1jwu B:1-92)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
   Uniprot P04229 30-219

8. Domain d1jwub2: 1jwu B:1-92 [84251]
   Other proteins in same PDB: d1jwua1, d1jwua2, d1jwub1, d1jwud1, d1jwud2

Details for d1jwub2

PDB Entry: 1jwu, 2.3 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2

PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1jwub2:

Sequence; same for both SEQRES and ATOM records:

>d1jwub2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d1jwub2:

• d1jwub2 first appeared in SCOP 1.65
  
• d1jwub2 appears in SCOPe 2.05
  
• d1jwub2 appears in SCOPe 2.07
  
• d1jwub2 appears in the current release, SCOPe 2.08