Lineage for d1jwub2 (1jwu B:1-92)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326974Protein Class II MHC beta chain, N-terminal domain [88819] (13 species)
  7. 326997Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (6 PDB entries)
  8. 327000Domain d1jwub2: 1jwu B:1-92 [84251]
    Other proteins in same PDB: d1jwua1, d1jwua2, d1jwub1, d1jwud1, d1jwud2
    mutant

Details for d1jwub2

PDB Entry: 1jwu (more details), 2.3 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2

SCOP Domain Sequences for d1jwub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwub2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1jwub2:

Click to download the PDB-style file with coordinates for d1jwub2.
(The format of our PDB-style files is described here.)

Timeline for d1jwub2: