Lineage for d1jwua2 (1jwu A:3-81)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501366Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 501399Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (8 PDB entries)
  8. 501403Domain d1jwua2: 1jwu A:3-81 [84249]
    Other proteins in same PDB: d1jwua1, d1jwub1, d1jwub2, d1jwud1, d1jwud2

Details for d1jwua2

PDB Entry: 1jwu (more details), 2.3 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2

SCOP Domain Sequences for d1jwua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwua2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOP Domain Coordinates for d1jwua2:

Click to download the PDB-style file with coordinates for d1jwua2.
(The format of our PDB-style files is described here.)

Timeline for d1jwua2: