Lineage for d1jwsd2 (1jws D:122-239)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894514Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1894515Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1894580Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 1894581Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
    Uniprot P23313
  8. 1894603Domain d1jwsd2: 1jws D:122-239 [84247]
    Other proteins in same PDB: d1jwsa1, d1jwsa2, d1jwsb1, d1jwsb2, d1jwsd1

Details for d1jwsd2

PDB Entry: 1jws (more details), 2.6 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1jwsd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwsd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOPe Domain Coordinates for d1jwsd2:

Click to download the PDB-style file with coordinates for d1jwsd2.
(The format of our PDB-style files is described here.)

Timeline for d1jwsd2: