![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54345] (18 PDB entries) Uniprot P23313 |
![]() | Domain d1jwsd2: 1jws D:122-239 [84247] Other proteins in same PDB: d1jwsa1, d1jwsa2, d1jwsb1, d1jwsb2, d1jwsd1 |
PDB Entry: 1jws (more details), 2.6 Å
SCOPe Domain Sequences for d1jwsd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwsd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
Timeline for d1jwsd2:
![]() Domains from other chains: (mouse over for more information) d1jwsa1, d1jwsa2, d1jwsb1, d1jwsb2 |