Lineage for d1jwsd1 (1jws D:1-121)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559492Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 559538Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 559539Species Staphylococcus aureus [TaxId:1280] [50229] (10 PDB entries)
  8. 559547Domain d1jwsd1: 1jws D:1-121 [84246]
    Other proteins in same PDB: d1jwsa1, d1jwsa2, d1jwsb1, d1jwsb2, d1jwsd2
    mutant

Details for d1jwsd1

PDB Entry: 1jws (more details), 2.6 Å

PDB Description: Crystal Structure of the Complex of the MHC Class II Molecule HLA-DR1 (HA peptide 306-318) with the Superantigen SEC3 Variant 3B1

SCOP Domain Sequences for d1jwsd1:

Sequence, based on SEQRES records: (download)

>d1jwsd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdgmfnwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1jwsd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdgmfnwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegn

SCOP Domain Coordinates for d1jwsd1:

Click to download the PDB-style file with coordinates for d1jwsd1.
(The format of our PDB-style files is described here.)

Timeline for d1jwsd1: