Lineage for d1jwsb2 (1jws B:1-92)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409679Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 409710Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (6 PDB entries)
  8. 409714Domain d1jwsb2: 1jws B:1-92 [84245]
    Other proteins in same PDB: d1jwsa1, d1jwsa2, d1jwsb1, d1jwsd1, d1jwsd2
    mutant

Details for d1jwsb2

PDB Entry: 1jws (more details), 2.6 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1

SCOP Domain Sequences for d1jwsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwsb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1jwsb2:

Click to download the PDB-style file with coordinates for d1jwsb2.
(The format of our PDB-style files is described here.)

Timeline for d1jwsb2: