Lineage for d1jwsb1 (1jws B:93-190)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760407Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1760415Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (40 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 1760440Domain d1jwsb1: 1jws B:93-190 [84244]
    Other proteins in same PDB: d1jwsa1, d1jwsa2, d1jwsb2, d1jwsd1, d1jwsd2

Details for d1jwsb1

PDB Entry: 1jws (more details), 2.6 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1
PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1jwsb1:

Sequence, based on SEQRES records: (download)

>d1jwsb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1jwsb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtf
qtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d1jwsb1:

Click to download the PDB-style file with coordinates for d1jwsb1.
(The format of our PDB-style files is described here.)

Timeline for d1jwsb1: