Lineage for d1jwsa2 (1jws A:3-81)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642339Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1642378Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)
  8. 1642384Domain d1jwsa2: 1jws A:3-81 [84243]
    Other proteins in same PDB: d1jwsa1, d1jwsb1, d1jwsb2, d1jwsd1, d1jwsd2

Details for d1jwsa2

PDB Entry: 1jws (more details), 2.6 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1jwsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwsa2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d1jwsa2:

Click to download the PDB-style file with coordinates for d1jwsa2.
(The format of our PDB-style files is described here.)

Timeline for d1jwsa2: