![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (8 PDB entries) |
![]() | Domain d1jwsa2: 1jws A:3-81 [84243] Other proteins in same PDB: d1jwsa1, d1jwsb1, d1jwsb2, d1jwsd1, d1jwsd2 |
PDB Entry: 1jws (more details), 2.6 Å
SCOPe Domain Sequences for d1jwsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwsa2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d1jwsa2:
![]() Domains from other chains: (mouse over for more information) d1jwsb1, d1jwsb2, d1jwsd1, d1jwsd2 |