Lineage for d1jwsa2 (1jws A:3-81)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326895Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species)
  7. 326918Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (6 PDB entries)
  8. 326922Domain d1jwsa2: 1jws A:3-81 [84243]
    Other proteins in same PDB: d1jwsa1, d1jwsb1, d1jwsb2, d1jwsd1, d1jwsd2
    mutant

Details for d1jwsa2

PDB Entry: 1jws (more details), 2.6 Å

PDB Description: Crystal Structure of the Complex of the MHC Class II Molecule HLA-DR1 (HA peptide 306-318) with the Superantigen SEC3 Variant 3B1

SCOP Domain Sequences for d1jwsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwsa2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOP Domain Coordinates for d1jwsa2:

Click to download the PDB-style file with coordinates for d1jwsa2.
(The format of our PDB-style files is described here.)

Timeline for d1jwsa2: