| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
| Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries) Uniprot P04229 30-219 |
| Domain d1jwmb2: 1jwm B:1-92 [84239] Other proteins in same PDB: d1jwma1, d1jwma2, d1jwmb1, d1jwmd1, d1jwmd2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1jwm (more details), 2.7 Å
SCOPe Domain Sequences for d1jwmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwmb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq
Timeline for d1jwmb2:
View in 3DDomains from other chains: (mouse over for more information) d1jwma1, d1jwma2, d1jwmd1, d1jwmd2 |