Lineage for d1jwma2 (1jwm A:3-81)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501366Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 501399Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (8 PDB entries)
  8. 501405Domain d1jwma2: 1jwm A:3-81 [84237]
    Other proteins in same PDB: d1jwma1, d1jwmb1, d1jwmb2, d1jwmd1, d1jwmd2

Details for d1jwma2

PDB Entry: 1jwm (more details), 2.7 Å

PDB Description: Crystal Structure of the Complex of the MHC Class II Molecule HLA-DR1(HA peptide 306-318) with the Superantigen SEC3

SCOP Domain Sequences for d1jwma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwma2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOP Domain Coordinates for d1jwma2:

Click to download the PDB-style file with coordinates for d1jwma2.
(The format of our PDB-style files is described here.)

Timeline for d1jwma2: