![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species) |
![]() | Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (6 PDB entries) |
![]() | Domain d1jwma2: 1jwm A:3-81 [84237] Other proteins in same PDB: d1jwma1, d1jwmb1, d1jwmb2, d1jwmd1, d1jwmd2 |
PDB Entry: 1jwm (more details), 2.7 Å
SCOP Domain Sequences for d1jwma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwma2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d1jwma2:
![]() Domains from other chains: (mouse over for more information) d1jwmb1, d1jwmb2, d1jwmd1, d1jwmd2 |