Class a: All alpha proteins [46456] (226 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (3 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (7 proteins) |
Protein Dodecameric ferritin homolog [47250] (10 species) |
Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries) ferritin homolog that binds to and protects DNA |
Domain d1jreh_: 1jre H: [84200] |
PDB Entry: 1jre (more details), 2.65 Å
SCOP Domain Sequences for d1jreh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jreh_ a.25.1.1 (H:) Dodecameric ferritin homolog {Escherichia coli, Dps} atnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfr talichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivan dvrkaigeakdddtadiltaasrdldkflwfiesnie
Timeline for d1jreh_: