Lineage for d1jree_ (1jre E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911056Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 911079Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 911108Domain d1jree_: 1jre E: [84197]
    protein/DNA complex; complexed with cd, trs

Details for d1jree_

PDB Entry: 1jre (more details), 2.65 Å

PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (E:) DNA protection during starvation protein

SCOPe Domain Sequences for d1jree_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jree_ a.25.1.1 (E:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiesnie

SCOPe Domain Coordinates for d1jree_:

Click to download the PDB-style file with coordinates for d1jree_.
(The format of our PDB-style files is described here.)

Timeline for d1jree_: