Lineage for d1jgna1 (1jgn A:6-98)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017239Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2017240Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 2017241Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)
  6. 2017245Protein poly(A) binding protein [63572] (3 species)
  7. 2017248Species Human (Homo sapiens) [TaxId:9606] [63573] (3 PDB entries)
  8. 2017250Domain d1jgna1: 1jgn A:6-98 [84170]
    Other proteins in same PDB: d1jgna2
    complexed with paip2 peptide, chain B
    protein/RNA complex

Details for d1jgna1

PDB Entry: 1jgn (more details)

PDB Description: solution structure of the c-terminal pabc domain of human poly(a)- binding protein in complex with the peptide from paip2
PDB Compounds: (A:) polyadenylate-binding protein 1

SCOPe Domain Sequences for d1jgna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgna1 a.144.1.1 (A:6-98) poly(A) binding protein {Human (Homo sapiens) [TaxId: 9606]}
pltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlespesl
rskvdeavavlqahqakeaaqkavnsatgvptv

SCOPe Domain Coordinates for d1jgna1:

Click to download the PDB-style file with coordinates for d1jgna1.
(The format of our PDB-style files is described here.)

Timeline for d1jgna1: