SCOPe 2.07: Domain d1jbmg1: 1jbm G:12-81

Lineage for d1jbmg1 (1jbm G:12-81)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
   forms homo and heteroheptameric ring structures
   Pfam PF01423

6. Protein Archaeal homoheptameric Sm protein [63758] (6 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
   MTH649, smap1

8. Domain d1jbmg1: 1jbm G:12-81 [84149]
   Other proteins in same PDB: d1jbma2, d1jbmb2, d1jbmc2, d1jbme2, d1jbmf2, d1jbmg2
   structural genomics
   complexed with acy, edo

Details for d1jbmg1

PDB Entry: 1jbm, 1.85 Å

PDB Description: Heptameric crystal structure of Mth649, an Sm-like archaeal protein from Methanobacterium thermautotrophicum

PDB Compounds: (G:) putative snrnp sm-like protein

SCOPe Domain Sequences for d1jbmg1:

Sequence; same for both SEQRES and ATOM records:

>d1jbmg1 b.38.1.1 (G:12-81) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
qrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvli
rgdnivyisr

Timeline for d1jbmg1:

• d1jbmg1 first appeared in SCOP 1.65, called d1jbmg_
  
• d1jbmg1 appears in SCOPe 2.06
  
• d1jbmg1 appears in the current release, SCOPe 2.08