Lineage for d1jbmg1 (1jbm G:12-81)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2786773Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2786819Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 2786833Domain d1jbmg1: 1jbm G:12-81 [84149]
    Other proteins in same PDB: d1jbma2, d1jbmb2, d1jbmc2, d1jbme2, d1jbmf2, d1jbmg2
    structural genomics
    complexed with acy, edo

Details for d1jbmg1

PDB Entry: 1jbm (more details), 1.85 Å

PDB Description: Heptameric crystal structure of Mth649, an Sm-like archaeal protein from Methanobacterium thermautotrophicum
PDB Compounds: (G:) putative snrnp sm-like protein

SCOPe Domain Sequences for d1jbmg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbmg1 b.38.1.1 (G:12-81) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
qrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvli
rgdnivyisr

SCOPe Domain Coordinates for d1jbmg1:

Click to download the PDB-style file with coordinates for d1jbmg1.
(The format of our PDB-style files is described here.)

Timeline for d1jbmg1: