SCOPe 2.08: Domain d1jalb2: 1jal B:279-363

Lineage for d1jalb2 (1jal B:279-363)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.10: TGS-like [81271] (3 families)
   possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif

5. Family d.15.10.2: G domain-linked domain [82583] (2 proteins)

6. Protein YchF GTP-binding protein, C-terminal domain [82584] (2 species)
   N-terminal domain belongs to the Obg family of GTPases some members of which contain a C-terminal TGS domain

7. Species Haemophilus influenzae [TaxId:727] [89836] (1 PDB entry)
   HI0393

8. Domain d1jalb2: 1jal B:279-363 [84141]
   Other proteins in same PDB: d1jala1, d1jalb1
   structural genomics

Details for d1jalb2

PDB Entry: 1jal, 2.4 Å

PDB Description: ychf protein (hi0393)

PDB Compounds: (B:) YchF protein

SCOPe Domain Sequences for d1jalb2:

Sequence; same for both SEQRES and ATOM records:

>d1jalb2 d.15.10.2 (B:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae [TaxId: 727]}
lqtyftagvkevrawtvsvgatapkaaavihtdfekgfiraeviayedfiqfngengake
agkwrlegkdyivqdgdvmhfrfnv

Timeline for d1jalb2:

• d1jalb2 first appeared in SCOP 1.65
  
• d1jalb2 appears in SCOPe 2.07