Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (3 families) possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
Family d.15.10.2: G domain-linked domain [82583] (2 proteins) |
Protein YchF GTP-binding protein, C-terminal domain [82584] (2 species) N-terminal domain belongs to the Obg family of GTPases some members of which contain a C-terminal TGS domain |
Species Haemophilus influenzae [TaxId:727] [89836] (1 PDB entry) HI0393 |
Domain d1jala2: 1jal A:279-363 [84139] Other proteins in same PDB: d1jala1, d1jalb1 structural genomics |
PDB Entry: 1jal (more details), 2.4 Å
SCOPe Domain Sequences for d1jala2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jala2 d.15.10.2 (A:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae [TaxId: 727]} lqtyftagvkevrawtvsvgatapkaaavihtdfekgfiraeviayedfiqfngengake agkwrlegkdyivqdgdvmhfrfnv
Timeline for d1jala2: