Lineage for d1j70a1 (1j70 A:1-168)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
    automatically mapped to Pfam PF14306
  6. Protein ATP sulfurylase N-terminal domain [63802] (5 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries)
  8. Domain d1j70a1: 1j70 A:1-168 [84118]
    Other proteins in same PDB: d1j70a2, d1j70a3, d1j70a4, d1j70b2, d1j70b3, d1j70b4, d1j70c2, d1j70c3
    complexed with na, po4

Details for d1j70a1

PDB Entry: 1j70 (more details), 2.3 Å

PDB Description: crystal structure of yeast atp sulfurylase
PDB Compounds: (A:) ATP sulphurylase

SCOPe Domain Sequences for d1j70a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j70a1 b.122.1.3 (A:1-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfl
nendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdv
ykpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

SCOPe Domain Coordinates for d1j70a1 are not available.

Timeline for d1j70a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j70a2, d1j70a3, d1j70a4
View in 3D
Domains from other chains:
(mouse over for more information)
d1j70b1, d1j70b2, d1j70b3, d1j70b4, d1j70c1, d1j70c2, d1j70c3