Class a: All alpha proteins [46456] (202 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (20 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (19 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (114 PDB entries) |
Domain d1j41h_: 1j41 H: [84111] Other proteins in same PDB: d1j41a_, d1j41c_, d1j41e_, d1j41g_ complexed with 2fu, cmo, hem, hni |
PDB Entry: 1j41 (more details), 1.45 Å
SCOP Domain Sequences for d1j41h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j41h_ a.1.1.2 (H:) Hemoglobin, beta-chain {Human (Homo sapiens)} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1j41h_: