Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.1: Thiolase-related [53902] (6 proteins) |
Protein Beta-ketoacyl-ACP synthase II [53909] (4 species) |
Species Thermus thermophilus [TaxId:274] [89792] (1 PDB entry) |
Domain d1j3na2: 1j3n A:250-408 [84075] |
PDB Entry: 1j3n (more details), 2 Å
SCOP Domain Sequences for d1j3na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus} riyaelvgfgrsadahhitephpegkgaalamaralkdagiapeqvgyinahgtstpvgd raevlaikrvfgdhakrlmvsstksmighllgaagaveaiatvqalyhgvipptinledp dpeldldfvpepreakvdyalsnsfafgghnavlafkrv
Timeline for d1j3na2: