Lineage for d1j35b_ (1j35 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682418Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1682419Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (6 PDB entries)
  8. 1682423Domain d1j35b_: 1j35 B: [84052]
    Other proteins in same PDB: d1j35a_, d1j35c_
    complexed with ca

Details for d1j35b_

PDB Entry: 1j35 (more details), 1.8 Å

PDB Description: Crystal Structure of Ca(II)-bound Gla Domain of Factor IX Complexed with Binding Protein
PDB Compounds: (B:) coagulation factor IX-binding protein B chain

SCOPe Domain Sequences for d1j35b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j35b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

SCOPe Domain Coordinates for d1j35b_:

Click to download the PDB-style file with coordinates for d1j35b_.
(The format of our PDB-style files is described here.)

Timeline for d1j35b_: