SCOPe 2.04: Domain d1j34b_: 1j34 B:

Lineage for d1j34b_ (1j34 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin beta chain [88867] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (6 PDB entries)

8. Domain d1j34b_: 1j34 B: [84049]
   Other proteins in same PDB: d1j34a_, d1j34c_
   complexed with ca, mg

Details for d1j34b_

PDB Entry: 1j34, 1.55 Å

PDB Description: Crystal Structure of Mg(II)-and Ca(II)-bound Gla Domain of Factor IX Complexed with Binding Protein

PDB Compounds: (B:) coagulation factor IX-binding protein B chain

SCOPe Domain Sequences for d1j34b_:

Sequence; same for both SEQRES and ATOM records:

>d1j34b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

Timeline for d1j34b_:

• d1j34b_ first appeared in SCOP 1.65
  
• d1j34b_ appears in SCOPe 2.03
  
• d1j34b_ appears in SCOPe 2.05
  
• d1j34b_ appears in the current release, SCOPe 2.08